DPCstruct | MC12000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023X7W1 | 6-75 | LKGVQLVVRDIRAARAELVGRGVEATEVRVLRSSGARPAKDDEDLNNVGFVFFSDPDGNGWAVQEINVRR |
| M3BZ50 | 4-76 | LPEPGGAEACRYLRERGVETVEIFHDTSDVFHRSSGATRRPGPDPERRTYRSYAVFNDPDGNEWVLQEVPAES |
| A0A5M3VWQ7 | 45-115 | None |
| A0A401MTK4 | 1-59 | None |
| A0A7K3EV83 | 1-69 | None |
| A0A1L5NWW7 | 26-91 | None |
| A0A081I223 | 361-435 | None |
| A0A120FIM5 | 10-60 | None |
| A0A1G8G687 | 42-127 | None |
| A0A810M7Q6 | 251-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.