DPCstruct | MC1200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8I0Y6 | 8-121 | RLCNTFGLAKFVFLACITLIVCGLIVGVILGKLIIYPYANESRFMPARCSHVSETFLGNQHCESRCSKDKSMFPCYAISVNVSGQDK… |
| A0A3S5FCN0 | 6-121 | LGGNTLGRKCNDSGLSKFIYIGCASLFTGGVIIECILGHLIMVPYREESKFIKAVCRYSASQSNRNKFMRCENKCLKSSSEFPCLAI… |
| A0A3P7L665 | 10-164 | None |
| A0A183KKR8 | 24-142 | None |
| A0A6P4Z1P7 | 4-113 | None |
| A0A183VYF3 | 66-181 | None |
| A0A095AHV2 | 1-119 | None |
| A0A1S8WVN6 | 33-175 | None |
| A0A0R3S9M2 | 3-125 | None |
| A0A0R3VUX2 | 21-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.