DPCstruct | MC11997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.98 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 48.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428NKE2 | 7-92 | MENERGQGMSHATGESKVPKAVQRKAPQSLEEKLPEAIHPTGSEPGQSTNKSHAKGGGEASIVPQKLQEKLPESIERAVPNAIHDT |
| A0A4U0U7X4 | 2-83 | SANESGQGVSHATGGSQVPAKAQEAVPSSVEHQLPDSLHDTGSNKETGKVSHATGDSKVPKVLQEGLPASVEKIVPNSIHDT |
| A0A1B9HHS8 | 4-81 | None |
| A0A074X141 | 1-81 | None |
| A0A0D2DNF3 | 86-177 | None |
| A0A2G5I008 | 8-85 | None |
| A0A0D2BE44 | 35-105 | None |
| A0A1B9GHP7 | 4-81 | None |
| A0A395SEY1 | 1-75 | None |
| A0A1Y2X3J8 | 4-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.