DPCstruct | MC11994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 74.24 |
| Assigned Pfam label(s) | PF16334- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9QTN8 | 144-242 | PSVPLVVKSPYLSTWMTSRQLMGDWPRFWNGNIKGMAGLVRVNGQTYEFMGHPTAEDIGTKLQAKQVSLKVTPTQSIFTFNAGPIAL… |
| A0A4U0TRZ8 | 1-127 | MHYTLPCLAALAGACSAQSSFSPLRPPALPLAVRSPYMNTWQQAGSDGGNGGYLAGEWPSFWMGQLTGWTGFVRVDNVTYNWLGGSN… |
| A0A2P2H2M5 | 347-454 | None |
| A0A7X9KTW0 | 177-285 | None |
| A0A533YN96 | 1-138 | None |
| A0A7R9ML57 | 138-238 | None |
| A0A1Q9DQ42 | 67-201 | None |
| A0A5B1QZR3 | 1-137 | None |
| A0A7R9LGV6 | 145-269 | None |
| A0A5N6EBQ5 | 11-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.