DPCstruct | MC11991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 183 ± 13 aa |
| Standard deviation of domain lengths | 13.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2RES3 | 7-176 | FSRLPRLSSLPRSVNFKRTTPGSLSPYLGAPPTTRILDPSHPAASIPRNKVLTSFPHLRTDGFLLRAVPKALLYAPESPYPDPPYGP… |
| A0A369J4W2 | 1-180 | MLRCPELSKLPKAPRYKSINFRRQTPGSVVSLFRNAPPNVLDPTHPAISLPISKFQTFRDKAFGINAHPFAVLAPSDHFWGHPFMQP… |
| A0A4S4L6T9 | 246-422 | None |
| A0A5C3PP05 | 1-204 | None |
| A0A067PA87 | 3-185 | None |
| A0A1X6MQ45 | 6-180 | None |
| A0A5C2SCR2 | 1-182 | None |
| A0A0C3DCE3 | 1-162 | None |
| D8QGV0 | 1-193 | None |
| A0A067N9J5 | 2-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.