DPCstruct | MC11990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10513 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1UKS6 | 133-230 | VEPPPEPQVNLPEASFKLIPDYNVRVADAPPRPNAYIRFIEKSAEELDGEVEYDVDEEDTAWLSIINKNRAKQGLPPVSVDTLELLM… |
| A0A0C3Q1S2 | 1-126 | MAPAGKENAPLPQISFRKVEDGDTTQPMGVHDGAARNYGYNGFKPFERPEHYIRHIEPLESELANQVEYDMDEQDQEWLDAMNRERK… |
| A0A0R3Q627 | 59-143 | None |
| A0A2K6GIS0 | 88-207 | None |
| Q2V6Q0 | 158-259 | None |
| A0A183HIW9 | 58-150 | None |
| A0A814AS99 | 74-186 | None |
| A0A7R8VLK3 | 214-320 | None |
| A0A0B7AWY9 | 162-266 | None |
| A0A504YT24 | 142-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.