DPCstruct | MC1199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 4.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CHW9 | 2-57 | PFTTSGATHGTLSEQFQQRHILTAARYFPYVKSRLVVVDTKQEILCPIEVALEDVH |
| A0A0S7GAZ3 | 1-60 | MYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRVNVIHKEEIILVPIEVAIEDMQ |
| F1QAS2 | 631-685 | None |
| A0A7R9JGD9 | 115-176 | None |
| A0A1X7SQM1 | 282-333 | None |
| A0A448WGZ6 | 79-132 | None |
| A0A2S2NM24 | 53-110 | None |
| A0A2H1CND6 | 1-67 | None |
| A0A5B7H9B9 | 49-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.