DPCstruct | MC11984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 170 ± 18 aa |
| Standard deviation of domain lengths | 17.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3L9K6 | 7-170 | ALPNPNPIVWISFTGGPNESVASFIQSVQRVAFQQNRIKNDEWVAELASTCFTDKALVWYLGLDKGTQSSWAKLRIALVKHYLVQPT… |
| A0A0C3MJ78 | 62-261 | TPLEKQDPSADHVQLTFSGSSGQEAEAFVQAVQRRAHAAGKLRDNDWIVDLVSVCFEGDALRWFESLDDKTQGDWKLMKAAILRQYP… |
| A0A0C3Q1I9 | 3-174 | None |
| A0A0C3QAR2 | 82-255 | None |
| A0A0C3Q6R6 | 34-185 | None |
| A0A0C3Q6M7 | 1-190 | None |
| A0A0C3Q6K7 | 82-250 | None |
| A0A0C3Q5V7 | 1-201 | None |
| A0A0C3Q5V5 | 82-242 | None |
| A0A0C3QSR1 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.