DPCstruct | MC11982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 3.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V2WZF6 | 1-82 | MDKSDSGYQMFNLLNKEFTFDVDMSALPCGLNGALYFVEIEADGGLSSQPGNKASAKYGTGYCDTQCPHDIKFIGGEANSEG |
| A0A0K6GFC6 | 118-206 | TSNTNIGSRVYLLADDSHYQMFKLKNQEFTFDVDVSNLPCGLNGALYFSQMDADGGMAKYTNNKAGAKYGTGYCDAQCPKDIKFING… |
| A0A5B0QET7 | 113-192 | None |
| A0A1W2TPV0 | 114-202 | None |
| A0A3D8RU07 | 88-169 | None |
| V2XCV7 | 55-145 | None |
| D0NGX0 | 36-120 | None |
| A0A2P2SX38 | 74-163 | None |
| L8WDJ1 | 116-205 | None |
| A0A0W0GEF1 | 395-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.