DPCstruct | MC11981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 213 ± 46 aa |
| Standard deviation of domain lengths | 46.36 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3REN0 | 14-185 | YAMIKISVEIGDRIFADLKSMVSIDTNIKWKDSGDQNDKKLFYVETYPGELILTSKVRGDIYPIDFGGQTMYVRSNSLLASYGDISV… |
| A0A0C3KFM0 | 1-182 | MVAMEGTVQIRGEVKVSFRKLFTGGEMAESIFSGFGEVLLAPDIWGDVFPINIDGHTTWKIGKDAFLACTSEVMRKNKSQGIGKGLF… |
| A0A0W0DAP9 | 41-269 | None |
| A0A537MFR5 | 124-367 | None |
| I2H189 | 27-228 | None |
| A0A355TT71 | 84-293 | None |
| D8LQM5 | 154-341 | None |
| A0A565C3P9 | 717-965 | None |
| A0A6N2D3R2 | 320-557 | None |
| A0A7D4X1M6 | 22-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.