DPCstruct | MC11979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 172 ± 23 aa |
| Standard deviation of domain lengths | 22.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A268IDQ2 | 1-133 | TKTMINNYAKAKLFFPIKNKKYSKEHLLLISLIYQLKGSLSISDIKETFQGINKMIVEEESFELEPFYHSYLQLSKENTVHFKKDIQ… |
| A0A848RNR7 | 10-181 | LEDNKNNLKLVESLDKEIIGKVRNWKLLRWDELPDFEIYNDQLLSIVLSQVSPFLSEKDISPSMINNYVKQNLMPKPVKKRYSKEHI… |
| A0A1T4Q9G9 | 9-198 | None |
| A0A644TTU2 | 28-206 | None |
| A0A6N7UTF8 | 13-193 | None |
| A0A356B4D9 | 29-232 | None |
| A0A1Y4GX62 | 50-214 | None |
| A0A3B9G0A8 | 1-154 | None |
| A0A1H8JDI4 | 2-221 | None |
| X0P9X6 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.