DPCstruct | MC11978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 268 ± 14 aa |
| Standard deviation of domain lengths | 13.61 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X3BIM4 | 1-236 | MTDIYIDGDVALNHGSAGLGSSEEPGSIQINGDLELWNGARNIYGDVYVAGNFSLKDARIHGNVYVDGNLTLGWTPWIADDAHIYYT… |
| A0A7K4DHY5 | 54-321 | SGGNVNGPGATVIITGGLVTTDANQGASINVSNIYFDGDVTLSSGSASLGSRDEPGSIYINGSLTLRNGQRHIYGDVYVNGNCDLGS… |
| A0A3D5NSE8 | 3-264 | None |
| A0A3R7VQI3 | 190-464 | None |
| A0A265Q8A8 | 530-802 | None |
| B0TDZ5 | 361-636 | None |
| B1I3F1 | 282-550 | None |
| H1YWB1 | 852-1121 | None |
| A0A6F9WZK7 | 53-343 | None |
| A0A1M5RHU1 | 173-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.