DPCstruct | MC11976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5U4H9 | 1-76 | MDGRTKCKILKGIRQRIADINGINYEPYPCSNTSDCKGTCAQCEKELDWLWRQLKQKESQGYQIYITPEDLKEYEF |
| A0A7J5JZF7 | 9-73 | GKVKCRVLRELRIKFAQQNNIEYHPAECHHHGDCKGTCPACDAELLYLKEMSEGLEKEGIVITYN |
| A0A1Q6SQD9 | 1-61 | None |
| A0A1G8UH07 | 1-68 | None |
| A0A3S0R9F4 | 4-72 | None |
| A0A1H5YZE4 | 63-140 | None |
| W4PEK8 | 4-74 | None |
| A0A843ERS4 | 1-71 | None |
| D3E092 | 1-73 | None |
| A0A229I2M5 | 4-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.