DPCstruct | MC11973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 145 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF07795- PF01992- CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3H3N0 | 1-121 | MRISDRTPLYPSIGTLYPDATAILAEAGDESALGAALDPFPVYRKIWEVHQGEGVDSKSIDDAFYERDVQMAELAFQSQMHFACFYA… |
| A0A3L7HFW3 | 16-157 | PILEFEADRRTFIITINSFSTELSKEDHAKLLPHCGRRYPEGLAQLARADDYEQVKNGADYYPEYKLFFEGAGSNPGDKTLEDRFFE… |
| A0A816NJT0 | 518-668 | None |
| A0A0A9X4U3 | 1-124 | None |
| A0A812DKV2 | 339-489 | None |
| A0A813FMR1 | 596-748 | None |
| A0A4V3WIS0 | 201-349 | None |
| R7QLV0 | 298-447 | None |
| G1T239 | 391-541 | None |
| A0A7J8C0Y2 | 45-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.