DPCstruct | MC1197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 27.52 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 87.12 |
| Assigned Pfam label(s) | CL0010- PF08148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HHU6 | 3-101 | DSQLQKFRDELKNRSRVLKMLGHIDTDGVLQLKGRAACLIDTGDELLITELMFNGTFNDLDHHQVASVVSCFVPCEKSSEQIRLRNE… |
| A0A3S5CNN3 | 2-146 | FYKAKAFEERLHHHWLHDDPRLESLLAALSRKSKIKRRLAILQTQLSRRLSLIQLDELASRKRVLRRLGFINEHDVVELKGRVACEI… |
| A0A7J6TW67 | 337-493 | None |
| A0A5J4YIN4 | 769-983 | None |
| A0A6P5N474 | 13-150 | None |
| A0A6A6L663 | 334-488 | None |
| A0A2G8LKP6 | 252-403 | None |
| A0A177UWT4 | 360-507 | None |
| A0A1A9XD18 | 1-121 | None |
| W5LXA7 | 37-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.