DPCstruct | MC11968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 53 ± 1 aa |
| Standard deviation of domain lengths | 0.99 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 71.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5C0F3 | 324-376 | RHTGKGVHLYYVGGKVYAECLSDSNIFVQSWNCNYQHGFHPTTVCKIPSRCSL |
| M7AZU2 | 224-276 | RHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSL |
| A0A0R3U5G2 | 24-76 | None |
| A0A833W226 | 383-435 | None |
| A0A834K8H3 | 620-672 | None |
| S9X2D9 | 181-236 | None |
| A0A6A4SUY8 | 330-382 | None |
| A0A3S5AC63 | 78-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.