DPCstruct | MC11966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 17.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 72.11 |
| Assigned Pfam label(s) | CL0123- CL0608- CL0063- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5RSS6 | 17-184 | NHHSIAEPTIVAEAYDRVSGDRLKLFLTLDDKDIIEDAGYRIEGNQTCLASTSLLSELLLNRHMEAAAKISPDQLRAGLDELPEEQL… |
| V6KTJ5 | 127-284 | EPLRLRSAVVDVACLGEPDAAEGPGVRQITLTDPGRNRYARLAVRDDKIVAAVLVGLPQAIATLGLLHRRGQYLPADRLGLLLDLPA… |
| A0A7Z7IYV5 | 182-326 | None |
| A0A377DLR7 | 130-294 | None |
| A0A251XSL9 | 40-188 | None |
| A0A3E1RA76 | 419-556 | None |
| A0A517SRM8 | 144-302 | None |
| A0A7Y5T5A0 | 47-205 | None |
| A0A0K2RFC3 | 3-114 | None |
| A0A5C7N2P0 | 794-947 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.