DPCstruct | MC11964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 150 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1AUM8 | 128-285 | DTAASEPPEHPQDDDVAGPAADSAAGLIARGSKSARARTKRLATKAAEVLGALQSALQAEEAERLAAAEAARAKAREQAERAAKERK… |
| V6JZE3 | 4-158 | AALRRLLDEIDQQGGPEAARENRLHLSDESPEHMTATTEPLPVGRLLKWADEQPDRDVRDQAARARVALASLRKRYDTDQELTAITT… |
| A0A345XSQ1 | 92-250 | None |
| G2G8S0 | 334-504 | None |
| A0A285KKN6 | 28-177 | None |
| N0CHE5 | 1-148 | None |
| A0A1Q5ER45 | 75-218 | None |
| A0A5D0P0J4 | 52-184 | None |
| A0A255PX25 | 6-142 | None |
| A0A2N0EGU7 | 133-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.