DPCstruct | MC11963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 172 ± 16 aa |
| Standard deviation of domain lengths | 16.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.65 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0169- PF08974 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5X7E2 | 1-167 | MSLIGHAYLLPEAKIQALLQNPADVFGVIDGAYNAPEHGFVDLDKAWHCLHYLLSGSAQAGEGPLAFLLAGGTPVGDEDLGGAGPAR… |
| A0A7J5F0L5 | 102-278 | DESAPCLPVVAGPFDCCAIRHRARVIVMSMNGELRLIPPELMDQLDDEAVVEGLMVGDGISVGKAWNGLHYLCCGDGTAGESAISGG… |
| A0A2N6T6F2 | 29-218 | None |
| A0A833H0A3 | 1-148 | None |
| A0A2M9KVH8 | 47-231 | None |
| A0A1Q7AXT9 | 1-162 | None |
| A0A5B8UK41 | 56-234 | None |
| A0A851GU99 | 12-209 | None |
| C2BIQ8 | 3-168 | None |
| A0A174QGA2 | 4-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.