DPCstruct | MC11961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 409 ± 62 aa |
| Standard deviation of domain lengths | 61.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 68.97 |
| Assigned Pfam label(s) | PF07624- PF07626- PF07637- PF07583- PF07627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5EX76 | 303-725 | VAANEIAQVVRQRRADVVACSPTDGSACGAEFIAQYAPRAYRRPLAPSEQAALQQVFDAYLAQDGFDVALELTTQVILQSPAFLYRV… |
| A0A2E4GLY1 | 51-422 | IDAFVKNRLKKQNIEPSPLSDRHTLIRRLHFDLIGIPPSHEEVKDFAYSDDENSYPKLVERLLNSPRFGERWARHWLDVVRYAETNG… |
| A0A7W0QBV7 | 31-326 | None |
| A0A4Q5X354 | 114-550 | None |
| A0A4Q5X6C0 | 69-385 | None |
| A0A4Q3JSY5 | 8-353 | None |
| A0A1Y6CDD0 | 213-619 | None |
| A0A800JJF4 | 1-288 | None |
| A0A1P8WEV3 | 634-1115 | None |
| B4D224 | 614-1020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.