DPCstruct | MC1196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.44 |
| Pfam Score | 92.17 |
| Assigned Pfam label(s) | CL0039- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061IQN6 | 209-315 | DRIYWNDGLDQYRLTPAELKQRFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQ… |
| A0A5A7Q1A5 | 3-111 | RLFPQQLRKEFERRQADAVFAFQLRNPAHNGHALLMNDRRRRFLEIGYKNPILLLHPLGGFTKADDVPLDVRMEQHSKSLTLLSSQS… |
| L5JPU0 | 108-230 | None |
| A0A812DJE8 | 423-527 | None |
| A0A7R9UXF2 | 123-236 | None |
| A0A3D1TFL5 | 465-561 | None |
| A0A813F7L9 | 438-542 | None |
| A0A0R3QEQ2 | 164-266 | None |
| A0A5E6N340 | 1-114 | None |
| A0A6A5D5S0 | 747-852 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.