DPCstruct | MC11955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 159 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7YVS9 | 18-168 | MSDKNMKFYLLSTIVRDYSSLELTVAVTKEAKSFSKSLLEMVKGYEKDWNYGNAIHHGNLVLGRVALYEGNLKAAKEYLILATKTSG… |
| A0A2N1HZ88 | 49-211 | EKTKEELKTKPFAKMSNREQRRFLYSNTELSARFDSKEQALFFIEKYEKHTNALGKFFSISKDMDMLHKTNIARAWLALKVGDKEEA… |
| A0A258VPC8 | 6-187 | None |
| A0A2V8M570 | 237-389 | None |
| A0A7X3Z2Z9 | 1-112 | None |
| A0A4P7HBF6 | 51-210 | None |
| A0A2V8R1F4 | 11-187 | None |
| A0A511MBS1 | 7-160 | None |
| A0A150P8X6 | 3-136 | None |
| A0A7H5F0G9 | 3-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.