DPCstruct | MC11948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 173 ± 33 aa |
| Standard deviation of domain lengths | 32.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830WAW3 | 1-132 | VSRVLTMLRLTGWLSLCKRVRDEKGRVRGNIYALHDEPLTCCDAEKFDPRYLDMVLDTVSRSRNKTIRHTASEVLSDIKNEPGMRHY… |
| A0A560S339 | 1-187 | MLQGQGVVTPRYEDLQPYLSSVPYGASASRETIARVLTMLRLTRWLSLVSRGRDQLSGRLQGSLYVLHDEPLTPAEAMELDQDYLEL… |
| A0A3R8UZM2 | 5-183 | None |
| A0A378MYM7 | 1-227 | None |
| A0A482Z513 | 92-214 | None |
| A0A497UCV3 | 13-198 | None |
| L7HAV2 | 3-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.