DPCstruct | MC11947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 120 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 73.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4RGL8 | 223-342 | ESGSPVASIATTPTADASQPNTVQAVPAALATPAIAAAFCELNGWDDQAWKKNLADPPAWLKKARIQKGSRKAGGAATWNPVTIALY… |
| A0A3E1DDX3 | 1-111 | MSTNINTQSDESITTVASKTEHAVNKKPSITKNAVINAFNGLHFNHAQWGLYLADPPEWLKVCRVDKGYKKIPATWDPVCIGKALLT… |
| A0A2S8RPT5 | 23-141 | None |
| A0A7G8W1E8 | 289-406 | None |
| A0A6S7AU71 | 202-324 | None |
| Q5P8W7 | 139-254 | None |
| K0HU55 | 113-231 | None |
| A0A2N7VPP4 | 170-295 | None |
| A0A0N1KZQ3 | 362-478 | None |
| A0A1W9KPP4 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.