DPCstruct | MC11946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 20.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1DDD4 | 38-200 | AIRKEPGEDLQAAIVRAHLHPVTNAAWTATKFQQSLADSGMVPLVAELSKHVEAVKIGNMNRPETMLLAQAHTLDVIFNSLAQRAGV… |
| F8GIE5 | 3-114 | EIDFTEAVAVMKEKSEKIIAGDLSELESTLAVQVVSLNAIFCTLTSRAATCEYLNQVETNLRLALKAQAQCARTVEVLAAMRNPPIV… |
| A0A522PTP0 | 1-188 | None |
| A0A2S6F240 | 9-164 | None |
| A0A2M7ZYR7 | 10-149 | None |
| A0A1G0EE87 | 11-173 | None |
| A0A5S5B6H4 | 1-155 | None |
| A0A522SCX1 | 10-160 | None |
| A0A2R5FB04 | 3-161 | None |
| A0A2J7V8L7 | 54-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.