DPCstruct | MC11944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 130 ± 25 aa |
| Standard deviation of domain lengths | 25.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4IQZ3 | 2-96 | EDEMDSRRLQELYPIMARRLQPYVEEVCTRLEYPGSMMYDEYPDRLSLLRQAKSVWEEARAQENFEEPEPKWEQLQDLIGVLLLQEM… |
| A0A3D3RMF6 | 14-141 | CGSYRENPENLVEDERKCEKDMRYFRSCYPERARRMVEALCDQCDQLEYNDSCMMAEYPDKETIYRMVEKIYEESQKVGKMDPNRNE… |
| A0A1Y4VGZ7 | 88-220 | None |
| A0A6P1TKA6 | 258-435 | None |
| A0A1T5IM79 | 6-124 | None |
| A0A7C7EDW3 | 44-149 | None |
| A0A0L0W9H7 | 1-139 | None |
| A0A6L5YS54 | 2-132 | None |
| A0A419T1D5 | 4-121 | None |
| A0A6A7KBQ1 | 30-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.