DPCstruct | MC11940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 65.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841VTZ6 | 2-60 | RPERMQKLKVAANSGENPGFDFLKKCWNDDPALQIVIKKLLAKFPQWGIAFVDGVLVNW |
| A0A2K8T923 | 16-88 | WSYEAIVARSNLRPARREKLNRAANSGENPGFDFLQECWNDDPALQIVIKKLLVKFPQWGVAVVDGELIEWEK |
| A0A6P1KZW9 | 1-71 | None |
| A0A367RYB8 | 33-126 | None |
| A0A367QQJ0 | 16-100 | None |
| A0A5P8WGC1 | 249-336 | None |
| A0A6N0LND9 | 49-134 | None |
| A0A5Q0GQ17 | 119-211 | None |
| B2JB81 | 285-372 | None |
| A0A2K8SJ90 | 207-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.