DPCstruct | MC1194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A132A0K9 | 114-186 | DCREINNATKYANELYQESVNVPFMAKFVLFAKRFEPNESQIRVFCMTDDKEDKTLENQENFVEIAKSRDVEV |
| O70511 | 1295-1367 | DCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEV |
| A0A183WI81 | 1-74 | None |
| A0A3P7G912 | 120-192 | None |
| A0A6G0HHZ7 | 39-116 | None |
| A0A0J9XLX3 | 1-74 | None |
| A0A060XFZ1 | 2-83 | None |
| A0A183MIW5 | 399-471 | None |
| A0A3P6QF30 | 2-65 | None |
| A0A3P8WE13 | 1066-1138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.