DPCstruct | MC11938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 46 ± 4 aa |
| Standard deviation of domain lengths | 3.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 77.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B2J3Z4 | 172-214 | GQNPGFDFLQECWEDDPALQIVIKKLLAKFPQWGVAIVDGALV |
| A0A2K8T6H9 | 1-42 | MDFLQKCWSDDPALQIVIKKLLAKFPQWGIACVDGVLVDWER |
| A0A841VTZ6 | 16-60 | None |
| A0A367RYB8 | 81-126 | None |
| A0A5P8WGC1 | 288-336 | None |
| A0A6N0LND9 | 92-136 | None |
| A0A6P1KZW9 | 25-69 | None |
| B2JB81 | 327-371 | None |
| A0A2K8TA49 | 51-94 | None |
| A0A2K8T9J2 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.