DPCstruct | MC11937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 144 ± 14 aa |
| Standard deviation of domain lengths | 14.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402DJR6 | 31-168 | GGKVPSGRIVKDIVQRILERTKIPIPYRVGDVCEILIKDNPDLRGLGGCWCIVIEVREFSCLVRAWNGEYTVREENLRDLQYSPDHR… |
| A0A2K8T3V9 | 5-143 | GGKVPSARVVSDVVQRIMERTKAPNPYRVGEVCQIIAKDNPDLRGKGGNWCIVNHVGEVSCTVTMWDGEYTVRINHLKPLNYLESEC… |
| A0A2T1C3D0 | 427-564 | None |
| T2JQN6 | 2-123 | None |
| T2JMC1 | 403-557 | None |
| A0A433W821 | 80-232 | None |
| A0A433VEM4 | 217-363 | None |
| A0A433V7B9 | 234-371 | None |
| E0UMQ8 | 433-611 | None |
| A0A351L6H1 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.