DPCstruct | MC11936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9QBI7 | 3-69 | INHLQAVWLDSISLEIIYRGLYHFYVAHQKGKPIDPIKYFAAPENQDFGIVKQQRKPNVKLIVAPFP |
| A0A0D6KTY1 | 11-78 | DVIADELFLPFERISLKMVFRGLYHFNHAYSKGKATDRVWFFTAPENKCLDIVKTIPKKPQQLDLSPF |
| A0A6M0AJM0 | 40-109 | None |
| A0A4Q9JG28 | 19-90 | None |
| A0A0M4TNL6 | 23-94 | None |
| A0A140KDH7 | 34-105 | None |
| A0A6I5NM46 | 1-60 | None |
| A0A1Z4TUW7 | 2-53 | None |
| A0A139WWC6 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.