DPCstruct | MC11935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 20.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 63.74 |
| Assigned Pfam label(s) | PF06405- PF05996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YNB4 | 6-105 | LSAISYKKFINFALDETKRHTHLAPSPLQERYNSRISMDGKSEIEMLSFEATKVRLLRSLCIESQTMQVLDFAVFPEPEFDMPIFCA… |
| A0A2K8T2F1 | 1-117 | MQTSLRTRQHPLIHRLADSIEEIWQQYLDISPYSVPEGLGYVEGHLEGERLIIENHCYQAPQFRKLHLELAQVGNGLDILHCVMFPN… |
| A0A4Q4CK90 | 21-136 | None |
| A0A4P1RRY8 | 1-107 | None |
| A0A0A9NED2 | 1-114 | None |
| C1E1C9 | 2-111 | None |
| A0A0E0JTL7 | 236-346 | None |
| D8R136 | 24-144 | None |
| A0A0P0XTW6 | 58-212 | None |
| A0A482SGI5 | 34-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.