DPCstruct | MC11934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 135 ± 14 aa |
| Standard deviation of domain lengths | 13.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8SWD5 | 1-134 | MTTAINTDKEYQNRLKQFTSLKSKYQATKYNDSSPSSLLYLILRKVDLGIELTELEFSWLREQELFETVEIVCQKQQSKLEELIKLE… |
| A0A846FYS6 | 84-195 | AIANQIKEFAELKIKYHATKYQDFFPDKLFDILKKIDSAETLSKQEYNWLSNHGLLETLKIYLKQEKEKQQKQREAEAKFAELKDKY… |
| A0A845YTD0 | 103-231 | None |
| A0A1Y1Q1G0 | 1-138 | None |
| B4VL49 | 4-138 | None |
| A0A6P0WVG1 | 23-184 | None |
| A0A1Z4K4L4 | 1-119 | None |
| A0A846FVX7 | 4-140 | None |
| A0A433NQU7 | 3-127 | None |
| A0A496VFS9 | 149-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.