DPCstruct | MC11931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 384 ± 70 aa |
| Standard deviation of domain lengths | 69.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 93.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655JL47 | 123-498 | ASELRRLRRCIAAAAGADHPLLPAAVAALLRHIGRYRCDYPGQAAVLPCALAETHSTTPQLAPGLQLIAAAVARGGEPAVRLQQLCG… |
| W4SAY4 | 62-457 | LQTEFNRAVGALSALARLDPPTREFSPQMLARGLCVLLRWFPVYRTYAGAKGVTGSEAERLRATAARAREGMPESIVAAVDAIERWL… |
| A0A4Q2Y5G7 | 57-409 | None |
| A0A538DLK1 | 1-453 | None |
| A0A3N5NQC4 | 2-414 | None |
| A0A6N9YFC3 | 2-283 | None |
| A0A7V9DM54 | 267-666 | None |
| A0A532E898 | 330-599 | None |
| A0A7C1H7F3 | 266-724 | None |
| A0A2V7XZT3 | 307-759 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.