DPCstruct | MC11930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427XCF4 | 80-182 | DSDGSGSSTTCTTNAVSVFEAFVSFLRTNGRRALLTEFGGGNNAGCATYVSQALSYLSANSDVVLGFTAWSAGAFDTTYELSLVPNS… |
| W4S4U5 | 2-85 | VTPFIDALRDAGKRGYLGEHGYPAGNRSAEVATTRMLAHLQANNIPSTQWCFGPGWPDDDVLGMSRDVGADIQAKSNLAAVQAF |
| A0A3C0ENL0 | 791-870 | None |
| A0A840YTL7 | 3-91 | None |
| A0A815T277 | 19-105 | None |
| A0A820R585 | 50-136 | None |
| B5ZX72 | 638-744 | None |
| A0A430DV83 | 416-494 | None |
| A0A815WRF8 | 647-733 | None |
| A0A1H9Q2V8 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.