DPCstruct | MC1193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 194 ± 24 aa |
| Standard deviation of domain lengths | 23.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 88.49 |
| Assigned Pfam label(s) | PF19256- PF14443- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4VTJ3 | 1-180 | MKVVELRAELDARMLNSKGLKSQLIARLTKILKNEQEKEESEKAANAESTETDEAKKQEEEEKKKEEERKKKEEEERKKEEEEKKKA… |
| A0A3S5CM66 | 1-180 | MSVSDLRNELALRNIDSKGLKAQLQSRLQTALDDEKAKENAGGDKTDDDTRAEQTPTKTATPAAGSTHQEKEKDDSKQLSEKDRRRL… |
| A0A183VJ51 | 293-461 | None |
| A0A817ZYZ0 | 1-218 | None |
| A0A1I8IR52 | 1-181 | None |
| A0A016TTW6 | 30-273 | None |
| A0A564Y663 | 386-594 | None |
| A0A0N0U5T9 | 503-697 | None |
| A0A2J7RN41 | 1-169 | None |
| A0A1B6LM80 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.