DPCstruct | MC11928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 306 ± 37 aa |
| Standard deviation of domain lengths | 37.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839HTM8 | 36-329 | VHAGPEPIRSAASAGTQIAAAVQSQSRPGMSLFVLVGLGLLVVLLGWRWRMRFLPDPGRTLHLPVSARQRTALPSTSHQASTRADVA… |
| A0A554XR64 | 129-456 | APGTKAGGDPAGAPAAVPADAPAPRAEPNPAVQQELATLRAEQQRLLLAVESLNRELTAARSARGDGILYALAGVIVGLLGTLLWLL… |
| A0A849UH35 | 300-552 | None |
| A0A2N2S5F2 | 2-292 | None |
| A0A7Y4XE14 | 157-529 | None |
| A0A6M4A1U7 | 4-305 | None |
| A0A1E4PZ22 | 1-286 | None |
| A0A3S9HME3 | 6-246 | None |
| A0A1G3HGA7 | 78-401 | None |
| A0A1L6FA19 | 35-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.