DPCstruct | MC11923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 17.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.47 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0125- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3JBY1 | 57-196 | VAPTTICVPQLDVMPRRAGFSITSLSILSAHASAWLMLRTLPLHKMLRHVSRTSAHRYKDGDIAQCAAAFRASDAIVARTDRCLLKA… |
| A0A3M0HPF3 | 27-145 | RLSRFNIQVLRAAFWAAKACRETRKALPVSGVNTEVRVPASLPIGSRRGVDAVLRRLSPTCLERSLVKQRWLASHGVDAEVVIGVRR… |
| A0A059DT90 | 53-191 | None |
| A0A3M1RRJ1 | 8-137 | None |
| A0A1W9GUF7 | 17-155 | None |
| A0A410NT25 | 152-291 | None |
| A0A2P9I132 | 16-163 | None |
| A0A7M3LQX3 | 89-260 | None |
| A0A399ZDH0 | 9-144 | None |
| A0A316AZM0 | 89-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.