DPCstruct | MC11922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 208 |
|---|---|
| Mean domain length (aa) | 101 ± 15 aa |
| Standard deviation of domain lengths | 15.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.87 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF05188- PF01624- CL0540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3JA40 | 3-100 | AQYLTLKAQAQDCLLFYRMGDFFELFFDDAKAAAATLDIALTSRGEHDGAPIPMCGVPVHSAEGYLARLIKAGHRVAIAEQTETPAQ… |
| A0A435G816 | 2-66 | AEIVFQRAGDCLQAFNKDAIIVADILGLAVTRAPEDDADMVGMPNHAQADSFAALYAASHKPHLI |
| A0A2I9CJD1 | 31-136 | None |
| K3WE37 | 63-180 | None |
| A0A7R9KIP7 | 9-123 | None |
| A0A6S7FWY9 | 13-131 | None |
| A0A7X7XE34 | 6-108 | None |
| A0A368QAE6 | 101-219 | None |
| A0A2E4HL39 | 12-128 | None |
| J6EYG8 | 7-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.