DPCstruct | MC11921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 16.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.84 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0023- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NQ87 | 1-88 | LALDLRTRLHGQHLVQSVVLKAVQGFLSSPESNKPLTLSFHGWSGTGKNYVARIIADNLYRDGVKSECVRLFIAPFHFPHARLVDTYK |
| A0A819ATB0 | 7-117 | IFDMFCIMECCSNHWIKNDVKELDLRLKSQLIGQPLAYDLILRSIKSHTSNLNPSKSLVLSLHGGTGTGKNFVAKHIVESLYREGYK… |
| A0A3Q2SXH8 | 14-102 | None |
| A0A7R8Z8I8 | 116-220 | None |
| A0A7J6ZZU0 | 8-142 | None |
| A0A2B4SD41 | 10-130 | None |
| A0A834U6C4 | 955-1089 | None |
| A0A672KBR1 | 13-115 | None |
| A0A0S7JUG4 | 68-186 | None |
| A0A3P8XAK8 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.