DPCstruct | MC11920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 181 ± 37 aa |
| Standard deviation of domain lengths | 37.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.06 |
| Pfam Score | 83.92 |
| Assigned Pfam label(s) | CL0229- PF18102 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4F847 | 2-130 | RASVHPRPCAGHEASSSIELTYAFATGVQRSQHPSEGRPYAAVERRCVYPNDAVGGAAVMLLRLAFRRGLAFRIGDSATTGKSGVVV… |
| A0A819ASN3 | 85-308 | SLDAASGVPNEEKVDINHHNQNETEEMKMISSKEKKETEICAICLDDCTEPKELDRCGHVFCCTCIDQYFQSVKPQCPCCFTIYGEI… |
| A0A7D9LP94 | 321-515 | None |
| A0A7R9WB62 | 2-111 | None |
| V9L3W1 | 147-371 | None |
| R1CHT2 | 224-403 | None |
| R1BNG5 | 1-91 | None |
| A0A813USE9 | 178-387 | None |
| A0A6F9CTF5 | 2-104 | None |
| A0A812KJK4 | 44-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.