DPCstruct | MC11918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 315 ± 35 aa |
| Standard deviation of domain lengths | 34.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF17911- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3K3S3 | 22-276 | QIPSQEALLQEIEREILYPKDVIPEHWLSQYKLHWDHELSISSLFTLEPSPSSTVLTFQRSGLNGRIVGYSETSTNRVIATGLTSTS… |
| A0A818X3D6 | 1-314 | MTATKQFIRTDFDDILQSFVDENQFPWLDPSLHDRQLTTHDIDVNRLFTIEALKDESDLVADRNLTTGEIIGLCEVPIIPKPVVNIS… |
| A0A7J6ACK1 | 49-334 | None |
| A0A194RJY1 | 1-382 | None |
| A0A3P7IU57 | 1-287 | None |
| A0A016WJ43 | 39-375 | None |
| A0A4D9DH98 | 20-346 | None |
| A0A2B4SXW2 | 38-372 | None |
| A0A433D5I6 | 20-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.