DPCstruct | MC11915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 295 ± 27 aa |
| Standard deviation of domain lengths | 27.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A431HMQ4 | 37-347 | SRLVDFIKQEYSTEFSDFVESSLAIMLIENWAFLADTLSFKMDQIANEVFVDTVTEIENMFRLAKLVGFQPQPPIAAKSLWTASLNN… |
| A0A817A6W8 | 1-295 | MVKEVEEALTGALGSINLTPPSVFSVLINTFLIEVAKIDLKAEEIYNASYPNTATGYSLDGIADYNGIRLSATYSSVTAQVSAINYT… |
| A0A1A9WSI5 | 29-300 | None |
| A0A841VH02 | 13-299 | None |
| A0A3N9NA84 | 106-377 | None |
| A0A350PFI2 | 18-328 | None |
| A0A7W7H3F4 | 15-319 | None |
| A0A1I3EI96 | 582-882 | None |
| A0A5K8AAG7 | 563-839 | None |
| M5RE64 | 785-1071 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.