DPCstruct | MC11914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 150 ± 11 aa |
| Standard deviation of domain lengths | 10.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EW12 | 36-166 | VLIILINVIECCYSEICTNTEDVANCRKKTLAFEAISDLHSQLDGDSSGGVDFSEASRFLGDKLSYPVEHFRQTDLSQEDGIISLLD… |
| A0A820TSY8 | 2-154 | NQFIFYFILIINLFASGTSNKKNNNNNSVAYNIPDPDCTGVFNLCTDADKERLGRQAIKTIHEQMDDDKDGLIEASESRDFIHEELE… |
| F6TB84 | 2-141 | None |
| A0A671QPY9 | 5-159 | None |
| E9H7X9 | 1-159 | None |
| A4IFZ8 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.