DPCstruct | MC11913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 29.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EVC0 | 2-57 | CNCINTQYWNGSLCISKKTYNSTCVSSDECLGALFCNRGQCKCDRADYWSGSKCSQ |
| A0A820NJR7 | 212-267 | SQSWNGYGCSNLSTYGEYCLTNVQCDNSVFLICNNTYSRCTCNINSYWDSKICRSR |
| A0A814FZE1 | 38-102 | None |
| A0A813YNM4 | 96-147 | None |
| A0A8B6C375 | 241-293 | None |
| A0A8B6BMV8 | 118-172 | None |
| A0A8B6DCG2 | 176-230 | None |
| A0A814Q6N1 | 18-78 | None |
| A0A3M7QKM3 | 204-259 | None |
| A0A3M7QI92 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.