DPCstruct | MC11912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E2V1P3 | 1-90 | MVVGKYIPAIGNKAETIQREFYGQGMIYKNNEAYDSGLDIVCYIPEQSDSKYTHRDFLAMCNEQEEIAQVVFDSVDWQHPETYVDEQ… |
| A0A554IDD4 | 1-82 | MLETIGQKLPNGTYQKDFYRQGFVYKNFGNFQNQSGVCYVPELSETEYTYQDFLEMSGGNAEVAKDIFETVDWQHPETYLQE |
| I8Y5I7 | 2-102 | None |
| A0A5M8P356 | 112-209 | None |
| R6K4F9 | 4-96 | None |
| A0A6M5FPX6 | 6-94 | None |
| A0A4Q0J676 | 72-181 | None |
| A0A0A7G2Y4 | 4-105 | None |
| A0A1Y3TMZ8 | 77-166 | None |
| A0A1C5KLU1 | 129-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.