DPCstruct | MC1191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 175 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0123- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0J8I0 | 1-182 | MERLCRFVYAKDRTDRIRTCAILCHIYHHALHSRWYRARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLIKDAHNALL… |
| A0A3S5CKY8 | 1-152 | MEQLCRYIYSNDKTDRLRTRAILCHIYFLALYDHWYKARDLMLMSNLQMNIDHADQSTMILYNRAIVQLGLCAFRQGHIREAHNALV… |
| U6JQP8 | 317-498 | None |
| C5L9H5 | 62-254 | None |
| A0A376B2L8 | 529-730 | None |
| E2LUV5 | 451-593 | None |
| A0A7J5Z1G6 | 352-510 | None |
| A0A820XGB2 | 89-262 | None |
| A0A7J9IPI3 | 178-344 | None |
| A0A835HKD4 | 56-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.