DPCstruct | MC11908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 324 ± 63 aa |
| Standard deviation of domain lengths | 62.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4DSU4 | 39-381 | QKFHVQILQLCEISSVAVRQLAFEVLQLCAEGGLLPPSKYASALIVLAADPQNEVIRKAAVDCMASQTKRYADIVAANAATGVVKAF… |
| A0A1B8DL76 | 5-288 | CKYVMETALATQGDQGLLALEVLASMNQQGIIHPKKCAAICVALGTSQNREIAELSFSMLRILHSKFEAIMRRQYIRAVRAAYEYRR… |
| A0A0B1SYQ9 | 264-542 | None |
| A0A7S2UEU1 | 3-254 | None |
| A0A6P8HDP2 | 2-341 | None |
| A0A7R9B8G2 | 168-416 | None |
| A0A168HG05 | 22-316 | None |
| T1FAU5 | 12-325 | None |
| A0A3F2S431 | 122-440 | None |
| Q54RK7 | 1679-2020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.