DPCstruct | MC11906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 165 ± 27 aa |
| Standard deviation of domain lengths | 27.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1SF99 | 216-339 | THLQYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQAEIKTLERYMCSRFFIDFPDVVEQQKKIESYLRNHFIGEEKSKYDYLMTL… |
| A0A820N3R9 | 15-163 | THLNRRLIATTSPERICGGGLLKYCLLLTRDYRPYDNGIASWQLEKLMCSRFFIDYADINEQEYKLLAFLSSHFSNDDSAKYRYLLQ… |
| T1FNH1 | 236-423 | None |
| E4YC80 | 300-428 | None |
| A0A3B3QES8 | 723-892 | None |
| A0A6A4VN96 | 636-793 | None |
| A0A4U1EG31 | 238-398 | None |
| A0A2R8Q5G3 | 1-120 | None |
| A0A3B3YDM3 | 539-752 | None |
| A0A3M7RVN1 | 222-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.