DPCstruct | MC11905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Standard deviation of domain lengths | 27.27 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 95.28 |
| Assigned Pfam label(s) | PF02441- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9MBA2 | 12-114 | PKSLPLSGKKVVVTAGPTREVIDPVRFFTNRSSGKMGYAIAEAAQQMGADVTLISGPVSLTEPDHVHVVHVESAEEMYQAALDVYGE… |
| A0A820LYZ2 | 4-112 | MKIDLELVQAFLTKFQTTDRSIVLVTSGGTTVPLEKNTVRFIDNFSTGQRGAASVEYFLEQNYIVLFFYRLSSTLPYQRHIKNIFDE… |
| A0A067BWC4 | 21-187 | None |
| A0A835H3G1 | 218-388 | None |
| A0A524PRT4 | 2-101 | None |
| A0A2H6K7Q4 | 2-118 | None |
| A0A832HCG9 | 175-289 | None |
| A0A1S3P2B4 | 18-177 | None |
| A0A1D2NKT6 | 342-490 | None |
| A0A6I8PHF5 | 68-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.